PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1239_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 537aa    MW: 58269.2 Da    PI: 9.7984
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1239_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.74.3e-1248108262
                 XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                 ++ ++  r+++NRe+A+ sRqRKk ++eeLeekv  + +  ++L  +++    e a+l+++
  RrC1239_p1  48 EDERKRARLIRNRESAQLSRQRKKHYVEELEEKVRHMHSTITDLNGKISFFMAENAALRQQ 108
                 55566779*******************************9999999999999999888886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.0E-1747111IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.10549109IPR004827Basic-leucine zipper domain
PfamPF001708.3E-1150109IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-1251109No hitNo description
Gene3DG3DSA:1.20.5.1707.1E-1751109No hitNo description
CDDcd147041.38E-1952103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MSIKVEETAA TTKRKKEDTS ESDESRSSKY RRSGEQESAV TVEEEGEEDE RKRARLIRNR  60
ESAQLSRQRK KHYVEELEEK VRHMHSTITD LNGKISFFMA ENAALRQQLG GSGMMCPPPP  120
PPPPPMGMYP PMGYQWMPCP PPYMLKQQGS QVPLVPIPRL KPQSALGSSK GKSKKSETKT  180
KKVASISFLG LLFCLFLFGA LAPVMNVSYG GISGAFYGNY RSNYVTDQIY SHRRSRVLET  240
SGSGAGSGGF NGNGMHCGRD SNISATESSV PPGNGSEPLV ASLFVPRNDK LVKIDGNLII  300
NSILASEKAV VASRKASESN ERKADPLISK DYPPALPLPG VGKIEDMAKH LYRSKAEKQK  360
ALSSGSDDTL KEKIKTKAAS GEMQQWFREG VAGPMFSSGM CTEVFQFDVS STSGAIIPAS  420
PAANVSSEHS NNATDTHMRK NRRTLRGLAI PLPGSDFNFT KEHQRNSSSK EIKPASSMVV  480
SVLVDPREGG DGGDIDGMIG GPKSLSRVFV VVLVDSAKYV TYSCVLPRSG APHLVTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013692497.10.0PREDICTED: bZIP transcription factor 17-like
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A0D3BP020.0A0A0D3BP02_BRAOL; Uncharacterized protein
TrEMBLV4MJL00.0V4MJL0_EUTSA; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein